Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YJL103C
Description Putative zinc cluster protein of unknown function; proposed to be involved in the regulation of energy metabolism, based on patterns of expression and sequence analysis
Aminoacid Sequence
Download FASTA
MTKKLPSELKQTRKSIQTACEFCHTKHIQCDVGRPCQNCLKRNIGKFCRDKKRKSRKRIE
KHGTQPYLNLGKRLVIHDVPSKTVSPSSVHLQRDFLSSDQEKPGKTPAHNTNIQYTYNIN
DNFQSAGSIPRITNFNTNNRQTVLENTSNNISASQAVHLMNDPIIPTVRKSTLNLKSHFL
EQHKAMQQPLATNCLVATSNVPVHSGMDDSNKSDDDVDDETNIHFDSMWCNDEYMKLKDI
VDISTPFLPNNSQIFSLQESEYPNPSASTRGNSSLHLTNLLNSTKSVNDQKDSSIGHSTS
TFNTYDEVVSRPFISLDMLHLNRGANANTHPSHNAKLESECDSSSHSDADLEKHDTDFIS
PSKFRELVKTPQDLYDNKCLIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQ
KHNLRYDLEVIIRSILERYAPIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTP
MCIWRRSGEICFVSNEFYSLTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYN
DINKRKKLLMLNACSSTSSKITEGFSFTTDGKAIFTKCNLLLSNGLYLKCACCWTVKRDS
FNIPILVMGQFLPIFEMD* 
Transcription Factor
Binding site(s)
CGGNNNNNNNNCGG
CGGNNNNNNNNNCGG
axctCCG
ctCCG
txaxxWAaCTCCGGagtD
axctCCGGag
CCGxxxxxxxxxCCG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator