Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YKL222c
Description Protein of unknown function that may interact with ribosomes, based on co-purification experiments; similar to transcriptional regulators from the zinc cluster (binuclear cluster) family; null mutant is sensitive to caffeine
Aminoacid Sequence
Download FASTA
>YKL222C YKL222C
MKNTELSQKKKLDRQSRRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRNRKQCEYKENTSA
MEDQLRKKYRRCSKLEMARRIEELESQLTKQSQPNIHEGQNPLSNMRYLSSKHNRHILYG
PTSYRAILATQTDTFAKYREEIWQVLKLSRNNWKREHHYSTLSEISSIETAPPHSGSPSV
IEYLCESLPNYEVLCEYLTDFFASDFYDSYQIVHKEKVLRDLQDCFVKGPRSHKTGQHTI
ISLNLDSKKNYYKVGVMTAIMCLASHPKEVPEAIEVFHKVLTSFVSAKVFYTERVQFLFL
RYLYINVAGLDGGDQSHCIFIHGLTIDTAIHMGLNEDLRRLYLSKNHPIEEIPYLERLWL
WILFTDVKISLSTGIPVRINDDFVNKVRLENYSSSGDILLYKTTLRLRNIMKQIHAREKP
PDIPLIIEDLKKFTIKMFKPLDFYLNASNLNGNEFTELQLWHATLHMIGSLSNLYTLTHQ
DFDARIFNFSVLAPLNSLHLCFNVLETYFELDNSKLSSKSLCLSKKWPHLNNALFLIYVN
AFRALIQIYTIFLQYMENKDIQLFIQRNSSALTYSICPGDFEGPHNKCISLKIAFKEMEN
IFDHIHQEKLKPLTQIWQNSYYFSIIISMEKIGRRAFNKGMKNIDEGPETENDATENSLT
TILNDLEGPLEDFSENFIDDILGSPSAFFDTAISGWSNFEDFFSR* 
Transcription Factor
Binding site(s)
VCGGa
VCGGaxxt
aaCGGARat
BaaCGGARATaaxxc
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator