Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YLL054c
Description Putative protein of unknown function with similarity to Pip2p, an oleate-specific transcriptional activator of peroxisome proliferation; YLL054C is not an essential gene
Aminoacid Sequence
Download FASTA
>YLL054C YLL054C
MSIASQKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSICSYEVEPGRINKSPTIENA
PHRDIRNITPASMSASGSFTSILNPSTKDWEMKNFAMNLSNAHDKLVVMNNTTIVDSPFA
FHSILQHDLYAKALTTCIHERILIDVERHRENVSANNKKRELNLTIGDIGPLFFIDKAAL
KFIENTSKTSKLYPPIDFLYNTYDYEQAHPEENNDKISINILLEELSKYFLNKNEVDGLI
VDFYKTIYPVYPLLEISLFEDNIRELLQLNEFNGYNIVFAGKDSRRKLETITLLTIILAF
SYRRLSLSTSHSFKESFGVKSNNLTLLAHKLLALMNVFQYVNEHTLCCLLYFFILRYLNP
DQADMYPTHSDILNLKFLENVAIKLGLNEEPFQYTRYVSESDDYPRLFNLRRKLWLGVQF
LKFGILIPEGDSDILSLEYLRSFMKTDESLPELFERNYASTNNLDLSLMATAENIYHLHL
SLQVLLTSCFPINGPSYLKEVLDNIDKTKDFLNQKFPLILSSLGEPRMKSLHINVPSSLA
NEESFDFSTFEENETFIANVISYTCTMNIYDSLSLHFENQCFKNALEYKTYYHRFTFTAI
QDYLTLLKLISEYFNGSLLHLREPFGFATQKVVRFSIHRLLIFQATLLVRLFYKKDTCDR
SSAAMGMLNDRNGRLSRVIEKMIKLMSYHMKLLVEIVISKLEKSYLGSFISVSIFRYIIY
LVDTDALSAFISDYWKSDAVMDERYSRIHRIVGLKWGMGRDKSFSFTSKLNNPQFLGSLD
LEILEELEKLISAQEFSRNFTEDVDESLQSEIDLMNYDNEALNQLMAIDLDKLLGIFPNL
SNF* 
Transcription Factor
Binding site(s)
tCCGxxxxxxxxxxCGGa
CGGccGa
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator