Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YLR278c
Description Zinc-cluster protein; GFP-fusion protein localizes to the nucleus; mutant shows moderate growth defect on caffeine; has a prion-domain like fragment that increases frequency of [URE3]; YLR278C is not an essential gene
Aminoacid Sequence
Download FASTA
>YLR278C YLR278C
MGRPRKNVSQEKIQQLKRELELAGNRTDVLLQDKKGRSRSCLLCRRRKQRCDHKLPSCTA
CLKAGIKCVQPSKYSSSTSNSNTNNNTPTAGTVPPTPHPVIKRELQDSSIGAGAGAATSL
NDMTIIKPISTSNSNVDAGDANEFRKTIKSVTTNSNPNLMRQDKDQYTIFLEKKLKSLET
LLDLSPGCNQYNYELSQYKKVSHLFSNNTSDYSRPNSSNMVILPLPSPSNKPLENTNNNG
SNVNAATNDTSASTNNINNNNAICQSASLLNDPLETLDFTKCIFAKYNLKKEFLMYDPIF
ELNEKLSRSFLDTFFTRLQFKYPILDEQEIYTFYDHYLHNKILIPPSSPATSSAAPPSNS
HSYSEIEFHFLSGRMWLVFSISAYLLMTTGKYKGFPPHRYFSTAIRHITKCGLHLNYVQQ
IELLTLLVLYIIRTDRDSLILYDIIKDVMGISKKKLHLNQWYPNDPFANKKLRLFWCVYL
LERMICVAVGKPYTIKESEINLPLFNNDSFYTKGVHAAAPSTNDHGVQFINQSLKLRRIE
SQFVETLQLLKNDSRSVKQSIDQLPLVRKFFEDLEVWRKSYSTLDVKNFENETLKLYYYR
SVRLLIQPYLEFFAPEDRLFRECQAAAGQICQLYKIFHQKTLNGHSTPAVHTVFVAGVTL
IYCMWLARNFDDQRRKKLGDASKHTRPLISASLFSTMDDLRACSVCLYVMTERSNFARTF
RDTFDQLMNATVGNLIERCGPDSSELIFMASSVAKRTEPKNINDEANKAISSGDTLHDSN
SANAANLSNSNDKNISHNGGMPPAVARIFGKGQAEEHAGFVENSQVDLAEQEKFKKKQGV
LEKTSVPKSLAHLLTKMDDRSRISNSSMSYTTSSSSSSSSSSSSSTLSFPSSQEKNLKIN
VNNDNNGMTISSVNREHNNNHNNNNDNNNNNNNNNNNSNNNNNVNNNDNESNSRSTTNNS
CNNGNNSQYVRNNNVTMENDVERPIQDQYIVKKPTNQTEFDWQVFQQQAFLQQQLAQHNL
QAYLSSLNTDTMTNRSPSKSSSISTASSHSDPIPIAMTQSPTPYPQTSNMLPQQHVSRPL
PQQQREQPQQHITSPQRFSESNFTNQLNNGMINSNPLQSAIFSNHTSENKQLRDVEESNF
STSPLRADYGNNIISSIPASFTSNSIPVSVKQARNGSSSGDILFSNGAHDMINNISTWTN
NSVLDALNSKSILQTIFPQSQEPSSLSMDKQQQQHQQQNMCSENNVTANNFQQTQNDPSY
NRNLFMMSNQEGVQYNLDETEKNGPKTQVEANTSANLHFDNVIPTVTNADIRKKRSNWDN
MMTSGPVEDFWTINDDYGFLT* 
Transcription Factor
Binding site(s)
CGGactCCG
aaCTCCGg
aAACTCCGR
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator