Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tda9p
Description DNA-binding protein, putative transcription factor; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; null mutant is sensitive to expression of the top1-T722A allele; not an essential gene
Aminoacid Sequence
Download FASTA
>YML081W TDA9
MSSEEFKGLPIKRDISSTIYADRPPALSAPPCVGATGNDKIQVLPIPKKSRTIKTDKPRP
FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES
INSKDKTEIDAINDKNIIQIQGNKQTILPTPSNPLAKTAVQLKKAAKEKKNGKQGKLDLS
PSYGANNHSTDVSPSVGNSSTPAVIEETDSSSHFPLPDTNIPTKSKRHASFSASSAFTYS
SDNFQKLHQQAKSDFDELQESIPHQVGFSTPQLTAQQLIENAIESGVVDLETLDLPPFLS
LDGLPPASSSAAVAASEQIDICPSSATDTISGANSTPNQAATAPPFQLPIARESSSLFLA
NTPYLSDFLTMGSSYGGSGGFAKSITADPSLDYFNYKNHSHPDSRHNNSSSGINYSNNKN
NNESIEKSQNNSNVINETIDHTDIHAHHADAHDDSFIESEEWLSKFIMDSQIDNDLKLNI
NHFNDIGFNNLHPQNPTTHSEPRNMHNENRDMHRSASKFQSVSENISPREQMSLFKTKQN
KAISKFLSDEKIPSTASPSSSASPVQFDKKNVDINEFLLDESVSNLFTTRQIDLFKKNVN
LYSPLFQNQKDAVSSTSLTPSLTTQTATTQSGPGWTDSSQKLTFFTEQLRNLIIKENNLK
SNLFPTVDELNHYVDLYQVEFHKYFPFIHLYSIIPSSENYPLVISISMIGALYGFHSTHA
LLLSKIARTRVRMFLENTRSNHDKTPIWLMQSLVLLTFTSIFSNDMNAFRTVNTQIMILV
QLIKISKLNYPLENFIKPPIESDHVLEYQDNPAVLNQFKAQYNTREQINRNFKYFILAQS
RIRICHIVLLISNLFKSLVDFDCCFHSIDLKCGVPCYNEVLFFCENSRTWNENLTRFNIV
LDSKFSLIEVSNGESNYEKCLMYLSNGNPYLYKNAKISFKTLLSLLISIHEKINIERDAL
KDSYESDFHAKNVQWRMHSRPLVATMLKHWELLYIKNGGILALSDENLPIINTNPSFRLI
IPLYFFAKLRKCLDIAPTLRCIWNQDWNSMNSSLEKVCYERESLREATEYAVSVITFWID
TVSVMKGKSTQTPIFTITCIFVSILVIAGYMRRLEDFAQNKNSDCMIGSLKSTDRILWLK
AFKTLKRIESHLSEREYKLQTFAEFLRVPDNGSLDIESLDSSLIENTLNSHDVTNQALDI
ITRTRLSSRTLYCGARILGDTPVWPVSLLFAHALQSRAIYNINHRKSVNSV* 
See documented regulated genes
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator