Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Tda9p
Description DNA-binding protein, putative transcription factor; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; null mutant is sensitive to expression of the top1-T722A allele; not an essential gene
Aminoacid Sequence
Download FASTA
>TDA9 YML081W
MSSEEFKGLPIKRDISSTIYADRPPALSAPPCVGATGNDKIQVLPIPKKSRTIKTDKPRP
FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES
INSKDKTEIDAINDKNIIQIQGNKQTILPTPSNPLAKTAVQLKKAAKEKKNGKQGKLDLS
PSYGANNHSTDVSPSVGNSSTPAVIEETDSSSHFPLPDTNIPTKSKRHASFSASSAFTYS
SDNFQKLHQQAKSDFDELQESIPHQVGFSTPQLTAQQLIENAIESGVVDLETLDLPPFLS
LDGLPPASSSAAVAASEQIDICPSSATDTISGANSTPNQAATAPPFQLPIARESSSLFLA
NTPYLSDFLTMGSSYGGSGGFAKSITADPSLDYFNYKNHSHPDSRHNNSSSGINYSNNKN
NNESIEKSQNNSNVINETIDHTDIHAHHADAHDDSFIESEEWLSKFIMDSQIDNDLKLNI
NHFNDIGFNNLHPQNPTTHSEPRNMHNENRDMHRSASKFQSVSENISPREQMSLFKTKQN
KAISKFLSDEKIPSTASPSSSASPVQFDKKNVDINEFLLDESVSNLFTTRQIDLFKKNVN
LYSPLFQNQKDAVSSTSLTPSLTTQTATTQSGPGWTDSSQKLTFFTEQLRNLIIKENNLK
SNLFPTVDELNHYVDLYQVEFHKYFPFIHLYSIIPSSENYPLVISISMIGALYGFHSTHA
LLLSKIARTRVRMFLENTRSNHDKTPIWLMQSLVLLTFTSIFSNDMNAFRTVNTQIMILV
QLIKISKLNYPLENFIKPPIESDHVLEYQDNPAVLNQFKAQYNTREQINRNFKYFILAQS
RIRICHIVLLISNLFKSLVDFDCCFHSIDLKCGVPCYNEVLFFCENSRTWNENLTRFNIV
LDSKFSLIEVSNGESNYEKCLMYLSNGNPYLYKNAKISFKTLLSLLISIHEKINIERDAL
KDSYESDFHAKNVQWRMHSRPLVATMLKHWELLYIKNGGILALSDENLPIINTNPSFRLI
IPLYFFAKLRKCLDIAPTLRCIWNQDWNSMNSSLEKVCYERESLREATEYAVSVITFWID
TVSVMKGKSTQTPIFTITCIFVSILVIAGYMRRLEDFAQNKNSDCMIGSLKSTDRILWLK
AFKTLKRIESHLSEREYKLQTFAEFLRVPDNGSLDIESLDSSLIENTLNSHDVTNQALDI
ITRTRLSSRTLYCGARILGDTPVWPVSLLFAHALQSRAIYNINHRKSVNSV* 
Transcription Factor
Binding site(s)
cCCCDCH
HgxaHtACCCCGCaxHtxxB
GAGGGG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator