Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YNR063w
Description Putative zinc-cluster protein of unknown function
Aminoacid Sequence
Download FASTA
>YNR063W YNR063W
MDRSKDARKRSISLACTVCRKRKLKCDGNKPCGRCIRLNTPKECIYNIDKRKDKRKIKNG
SKVFLFKNNTIDNGNNSILENKGLNEDLSSHIYEKEAPKFDSDIDISRFGTNDAVIFNND
GWDTSLPIDFDFDEFNTETTDFDDFLKLLGDNSPSKEQKSLSYSPTATGLSGVVKETESE
DNAPTRSRLIDVLFENKLHSVPGISKWHLYELESQYPNLECTEGNSDEKFLLSTVLCLGS
LTIRKRELLNHSNIDNRPLLPENSISKLTTDAFKYYNAAKTLVPDLLSHPTIDGFCGLVL
MANFMTMMISLEHQLYLSINALQLAVALNLNNNTKCKELLESNSDGIGVILLFWNIWCSS
CMLATIHGKNPFITLEQITTPLPCEISPRNKTNKLLIDFMQIRIKLATLQSKIFQRLYTS
STANEVPFVNLEREFEEVSLQITRLKGFPIFEEHLFYRSRVLMLELSCLRAQASFLLYRP
YLITGESLQAVTMAKSIIHEIWSQYTKQFPDNEKERHERLDWNFCYPLRTASLTLCISCI
ILLRYKQVVQFLKGTELFEYILALEILQDLVQVLPIEQNLIDIIKYPISPVQLSGDSFVE
FWGRILY* 
Transcription Factor
Binding site(s)
cxxxxaWTCTCCGAxxxcV
tCGGAGAW
Wtctccga
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator