Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yrm1p
Description Zn2-Cys6 zinc-finger transcription factor that activates genes involved in multidrug resistance; paralog of Yrr1p, acting on an overlapping set of target genes
Aminoacid Sequence
Download FASTA
>YRM1 YOR172W
MSKRGSLQDRASPSEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGCL
YTEKFTHKIETKELFGSTPNIELLKRIEDLEKRLDDKELTEKDVALSTSPFRNPYANFYY
LQCKGSGRRIVYGPTSLRTHLSNDDNRFVNTYNQLWSKVKIERNRWKARHKWTMKPETQL
LEGPPLEKTGSDILQQVCNVLPSFEQSSKIITDFFNTELETNEVSEVLDKTKIINDFTSS
FLPSDELLPNGERRIEKLLPSTKKNYYKIGVILMILCIRHFYKNTPEEIEKFLIMLTGLS
TAKVYFIERAQFLLLKYYHRELIWACGDDSHMISLVDLLCSTAIMLGLHLNIREIYKNQE
NIVGSMESLENLWVWIILSDFNVSLNIGRCLAINSSYFQVDECENGERLPKNTNNYSSTV
FFDQSNSCMGKLKRFLRLARPMLDQIYDRSAFPDLAENCKKLRNFVETEFHPISYYTDSE
LISKVPLCEIKVLAQVLNLLLTFYSLRYLIYKEKSVVLENNILQTILVSFSLVINTTILC
FNLDEKHFPEFFDHNCVHLPPFMALSLVYTNFLFPRASTGFCAFLYHKLTLFEKGYYLSS
NIKDQEVTDWDLSTLNIPLDKAMNLLTAFKIHSDIFAKWSNDNNKQLRIIMARSYTFVIN
IALESIYRAVLEKVIKYRTEVENTWLQQLQDELNGSYSLTDNVNTPIDPSLSDLGVTSAS
PLAGNSPGLPPEEVRNNSENASHNNETGPIETELAQTISNEFWTAYNLGWEELMSQPDYK
YLFDTQ* 
Transcription Factor
Binding site(s)
caxxcRCGGaaAtaagDcggt
aCGGAaAT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator