Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Yrm1p
Description Zn2-Cys6 zinc-finger transcription factor that activates genes involved in multidrug resistance; paralog of Yrr1p, acting on an overlapping set of target genes
Aminoacid Sequence
Download FASTA
>YRM1 YOR172W
MSKRGSLQDRASPSEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGCL
YTEKFTHKIETKELFGSTPNIELLKRIEDLEKRLDDKELTEKDVALSTSPFRNPYANFYY
LQCKGSGRRIVYGPTSLRTHLSNDDNRFVNTYNQLWSKVKIERNRWKARHKWTMKPETQL
LEGPPLEKTGSDILQQVCNVLPSFEQSSKIITDFFNTELETNEVSEVLDKTKIINDFTSS
FLPSDELLPNGERRIEKLLPSTKKNYYKIGVILMILCIRHFYKNTPEEIEKFLIMLTGLS
TAKVYFIERAQFLLLKYYHRELIWACGDDSHMISLVDLLCSTAIMLGLHLNIREIYKNQE
NIVGSMESLENLWVWIILSDFNVSLNIGRCLAINSSYFQVDECENGERLPKNTNNYSSTV
FFDQSNSCMGKLKRFLRLARPMLDQIYDRSAFPDLAENCKKLRNFVETEFHPISYYTDSE
LISKVPLCEIKVLAQVLNLLLTFYSLRYLIYKEKSVVLENNILQTILVSFSLVINTTILC
FNLDEKHFPEFFDHNCVHLPPFMALSLVYTNFLFPRASTGFCAFLYHKLTLFEKGYYLSS
NIKDQEVTDWDLSTLNIPLDKAMNLLTAFKIHSDIFAKWSNDNNKQLRIIMARSYTFVIN
IALESIYRAVLEKVIKYRTEVENTWLQQLQDELNGSYSLTDNVNTPIDPSLSDLGVTSAS
PLAGNSPGLPPEEVRNNSENASHNNETGPIETELAQTISNEFWTAYNLGWEELMSQPDYK
YLFDTQ* 
Transcription Factor
Binding site(s)
caxxcRCGGaaAtaagDcggt
aCGGAaAT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
External source Open in SGD external link
w3c xhtml validator w3c css validator