Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Usv1p
Description Putative transcription factor containing a C2H2 zinc finger; mutation affects transcriptional regulation of genes involved in growth on non-fermentable carbon sources, response to salt stress and cell wall biosynthesis
Aminoacid Sequence
Download FASTA
>USV1 YPL230W
MENTTNRNTAGVLTSSNGNFATNSVAASTPKRSKSARRKTFKCTGYDGCTMSFTRAEHLA
RHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKNHHSTSSHQRKPSSSSLSSSSS
ASSSSSASSSTSYSDPYRKTNINSGNMPMMAENEKAPQIIHSSPEFITSTRSIPPISPRS
IYNTQRQQQHQQQQHQQAPYYFPSHPITDSYYQYPLPSNNNTINYLPSVDVQYPLNVSPS
STSHPASEVIISSFPPRSMPSTSFKYKDSADFQARTTMNKYNIRPSNINVNTSNINNHLD
SFSPPFSPSTTVAEAKPIILPQYQQAFSQPPNGNKNNNMSSSKNGGKGGENFKNTDDRND
NNNKKRSETLSESDISVNTNKKRLSVDYILT* 
Transcription Factor
Binding site(s)
AGGGG
tcAGGgg
BaxaaaTTCAGGGGKaa
TCAGGGGT
TCAGGTAC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator