Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YPR015c
Description Putative protein of unknown function; overexpression causes a cell cycle delay or arrest
Aminoacid Sequence
Download FASTA
>YPR015C YPR015C
MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSSIMHAPLTPEINQ
AALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSPVIATPQPFPLTFVERQSCCPIYSTAA
SSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAV
VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK
IAKKKHQ* 
Transcription Factor
Binding site(s)
DDtxaKGATTTACgtcttxa
See regulon   
See documented regulated genes
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator