Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YPR022c
Description Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and the nucleus and is induced in response to the DNA-damaging agent MMS
Aminoacid Sequence
Download FASTA
>YPR022C YPR022C
MHGKELAGRLRKRENDNDLSPNSSSSPAERFRCPHPECNKTFSRQEHLSRHKLNHWPKEI
YVCSYVLPTTNAPCNKTFVRKDLLIRHEKRHSKVKNRLSRPSKDQISSSNKDFSKNAPYN
PSEVPLSTQSGTSTINLIKNSVNPPPSITQESKFRPFLQQAQQPQQVQQSQQPQQIQQLQ
QLQFPQQLRAPLQQPMLQQQMHPQQASPTFPSYDPRIRNNGQNGNQFFNLIFDNRTGVNG
FEVDAANNNGNGNDQNMNINPAVQQQRYQDRNFASSSYQQPLQPLTQDQQQEQYFQQQKL
AQQQQQQQQQQQQQQQLPPQNPFGDPLTSSSSGANLSVMQDLFSTNFLNSDPLQSFMQEL
SEAPQVSIEDTFSDKNTIPPNEKPVQQDEGFQNPPVMFELPQDNIKIPKAQPKFNDNPST
SVKDNLSSQKLNINELKRRSSKDSGVGNNSSLNYKEQLRHSMKSVPSFFHPDPLTKYKIS
KEKCQEMFSFVPELRYVSIESIHKSLKSFWLNFHPQYGLLHKPSFHVDKQPAILNLALIM
TGASFLGSEYREQISDPICGPLRWIIFSHADFQPPSKTYIIQSLLLVEGYEKTSTNRYLH
ERSFLHHGTTIQLLRRTPSLGGHPLMVKTGKTSGENSIQDPQEVYKRWIDFEMLKRIAFY
AFYMDTTHAVVFGYWNLFINSNQIQLTLPCPDQVWESYDLSYETLMEHGYGSTKRDENNT
FLSALMQLMKNVIQILRNNNIRRNKVNNGGIESTPTDLESTTDWNIQSLFGKKILLAGII
SILFQCQEEVNGDYFITNFRGGITDHLGLSWKDILSFAMNYWLHEVQKSCTDPKACRIST
PSEETLTNRKIDEDNGDGLCDDDLDLLSSDNPSNCKIPVIHISQIVLRILHHDYYIYAGA
PWRMNVPIGRDEYDMISRRILQFAKDPYNGGVAVVYAFQFLFEMFIIKENNVPTVVKSYN
INSDPVITRPYAIALTSLLIWSCNFALHGCEVSIWDNTEASKDECFQPDDSNGGNILGNT
DNNGSTIANNNLKEKNNYIPIESFEVYLLRMYRNLYVDSSLDVVSFQNDVWAKASLLQHI
SNTHFLCGMMQFMRDIFNKSYWDLGREFGKLFDNCLERSLGKTSPTCHNMFDV* 
Transcription Factor
Binding site(s)
cCCCAC
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator