Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Yap5p
Description Basic leucine zipper (bZIP) transcription factor
Aminoacid Sequence
Download FASTA
>YIR018W YAP5
MALPLIKPKESEESHLALLSKIHVSKNWKLPPRLPHRAAQRRKRVHRLHEDYETEENDEE
LQKKKRQNRDAQRAYRERKNNKLQVLEETIESLSKVVKNYETKLNRLQNELQAKESENHA
LKQKLETLTLKQASVPAQDPILQNLIENFKPMKAIPIKYNTAIKRHQHSTELPSSVKCGF
CNDNTTCVCKELETDHRKSDDGVATEQKDMSMPHAECNNKDNPNGLCSNCTNIDKSCIDI
RSIIH* 
Transcription Factor
Binding site(s)
TTACTAA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator