Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yap6p
Description Putative basic leucine zipper (bZIP) transcription factor; physically interacts with the Tup1-Cyc8 complex and recruits Tup1p to its targets; overexpression increases sodium and lithium tolerance; computational analysis suggests a role in regulation of expression of genes involved in carbohydrate metabolism
Aminoacid Sequence
Download FASTA
>YDR259C YAP6
MQNPPLIRPDMYNQGSSSMATYNASEKNLNEHPSPQIAQPSTSQKLPYRINPTTTNGDTD
ISVNSNPIQPPLPNLMHLSGPSDYRSMHQSPIHPSYIIPPHSNERKQSASYNRPQNAHVS
IQPSVVFPPKSYSISYAPYQINPPLPNGLPNQSISLNKEYIAEEQLSTLPSRNTSVTTAP
PSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQKAFRQ
RKEKYIKNLEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQHEAIRNAITMLRSEYDV
LCNENNMLKNENSIIKNEHNMSRNENENLKLENKRFHAEYIRMIEDIENTKRKEQEQRDE
IEQLKKKIRSLEEIVGRHSDSAT* 
Transcription Factor
Binding site(s)
gtctgMTTAcgTaAgcgac
See documented regulated genes
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator