Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yap7p
Description Putative basic leucine zipper (bZIP) transcription factor
Aminoacid Sequence
Download FASTA
>YOL028C YAP7
MRQRRSVVAVSVKPKGFKLGHKQGSMSTTSPPPSSPDGNVSTSGPSAIKLSKNWELPQRL
KPGRKPKSKRGDASANNDGSSKIKKVQTSNQKDQMTTKDHENEGAKGHEGKSDDEGNGSG
DENGVDSVEKRRRQNRDAQRAYRERRTTRIQVLEEKVEMLHNLVDDWQRKYKLLESEFSD
TKENLQKSIALNNELQKALPLIVNTPFQQQPENPPDNPISILEMVENFKPIGAVSLKKGK
LKAHC* 
Transcription Factor
Binding site(s)
TKaCGTRA
aCGTaAWT
CGTaAWTa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator