Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yox1p
Description Homeodomain-containing transcriptional repressor, binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; potential Cdc28p substrate
Aminoacid Sequence
Download FASTA
>YML027W YOX1
MSQETKMLPSLSSLLSGTEISSSPVSPSFTNPRTSFHLDDRGTIKLPPLNTSINRPRSVE
SALRHTVTSLHENSSAYGDDMLKHTQSDSALSSQLNSSQETVDESHENLLLTPLNSKKRD
YSVSSKKNDILTPLSAAKSIIIPSASKEKRRAFAFITHSQETFPKKEPKIDNAPLARRKR
RRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATSK
STTIIQTVSPPSPPLDVHATPLASRVKADILRDGSSCSRSSSSSPLENTPPRPHHSLNRR
SSTPSIKRSQALTFHLNPQKKTLTPVKTSPNSRVNKLINSIDHSPSKAKRPVSNPSGSPK
RKRKFGFKIVDQQPLKDLDPNAFRG* 
Transcription Factor
Binding site(s)
ttAATTAa
tccHatTAATTAaWxxxxS
tWaAttR
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator