Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Yrm1p
Description Zn2-Cys6 zinc-finger transcription factor that activates genes involved in multidrug resistance; paralog of Yrr1p, acting on an overlapping set of target genes
Aminoacid Sequence
Download FASTA
>YOR172W YRM1
MSKRGSLQDRASPSEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGCL
YTEKFTHKIETKELFGSTPNIELLKRIEDLEKRLDDKELTEKDVALSTSPFRNPYANFYY
LQCKGSGRRIVYGPTSLRTHLSNDDNRFVNTYNQLWSKVKIERNRWKARHKWTMKPETQL
LEGPPLEKTGSDILQQVCNVLPSFEQSSKIITDFFNTELETNEVSEVLDKTKIINDFTSS
FLPSDELLPNGERRIEKLLPSTKKNYYKIGVILMILCIRHFYKNTPEEIEKFLIMLTGLS
TAKVYFIERAQFLLLKYYHRELIWACGDDSHMISLVDLLCSTAIMLGLHLNIREIYKNQE
NIVGSMESLENLWVWIILSDFNVSLNIGRCLAINSSYFQVDECENGERLPKNTNNYSSTV
FFDQSNSCMGKLKRFLRLARPMLDQIYDRSAFPDLAENCKKLRNFVETEFHPISYYTDSE
LISKVPLCEIKVLAQVLNLLLTFYSLRYLIYKEKSVVLENNILQTILVSFSLVINTTILC
FNLDEKHFPEFFDHNCVHLPPFMALSLVYTNFLFPRASTGFCAFLYHKLTLFEKGYYLSS
NIKDQEVTDWDLSTLNIPLDKAMNLLTAFKIHSDIFAKWSNDNNKQLRIIMARSYTFVIN
IALESIYRAVLEKVIKYRTEVENTWLQQLQDELNGSYSLTDNVNTPIDPSLSDLGVTSAS
PLAGNSPGLPPEEVRNNSENASHNNETGPIETELAQTISNEFWTAYNLGWEELMSQPDYK
YLFDTQ* 
Transcription Factor
Binding site(s)
caxxcRCGGaaAtaagDcggt
aCGGAaAT
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator