Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Arr1p
Description Transcriptional activator of the basic leucine zipper (bZIP) family, required for transcription of genes involved in resistance to arsenic compounds
Aminoacid Sequence
Download FASTA
>YPR199C ARR1
MAKPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHI
LKKENELLHFMLRSLLTERNMPSDERNISKACCEEKPPTCNTLDGSVVLSSTYNSLEIQQ
CYVFFKQLLSVCVGKNCTVPSPLNSFDRSFYPIGCTNLSNDIPGYSFLNDAMSEIHTFGD
FNGELDSTFLEFSGTEIKEPNNFITENTNAIETAAASMVIRQGFHPRQYYTVDAFGGDVL
LSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL* 
Transcription Factor
Binding site(s)
TGATTACTAATCA
TGATTAATAATCA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator