Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Arr1p
Description Transcriptional activator of the basic leucine zipper (bZIP) family, required for transcription of genes involved in resistance to arsenic compounds
Aminoacid Sequence
Download FASTA
>YPR199C ARR1
MAKPRGRKGGRKPSLTPPKNKRAAQLRASQNAFRKRKLERLEELEKKEAQLTVTNDQIHI
LKKENELLHFMLRSLLTERNMPSDERNISKACCEEKPPTCNTLDGSVVLSSTYNSLEIQQ
CYVFFKQLLSVCVGKNCTVPSPLNSFDRSFYPIGCTNLSNDIPGYSFLNDAMSEIHTFGD
FNGELDSTFLEFSGTEIKEPNNFITENTNAIETAAASMVIRQGFHPRQYYTVDAFGGDVL
LSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL* 
Transcription Factor
Binding site(s)
TGATTACTAATCA
TGATTAATAATCA
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator