Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cst6p
Description Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family, proposed to be a regulator of oleate responsive genes; involved in utilization of non-optimal carbon sources and chromosome stability
Aminoacid Sequence
Download FASTA
>YIL036W CST6
MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATTTSTMNNSALSR
SLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQA
AYLRQQQQQDQRQQSPSMKTEEESQLYGDILMNSGVVQDMHQNLATHTNLSQLSSTRKSA
PNDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAH
LPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHNYN
GLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYSKSQQRNFVNAPS
KNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNPSFTPKSQGSHLNLAANTQGNPI
PGTTAWKRARLLERNRIAASKCRQRKKVAQLQLQKEFNEIKDENRILLKKLNYYEKLISK
FKKFSKIHLREHEKLNKDSDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDT
GKIIAIKHEPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK* 
Transcription Factor
Binding site(s)
TGACGTCA
TTACGTAA
aTGACGTCAY
YRHACGTCAt
ttACGTCAt
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator