Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Cst6p
Description Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family, proposed to be a regulator of oleate responsive genes; involved in utilization of non-optimal carbon sources and chromosome stability
Aminoacid Sequence
Download FASTA
>YIL036W CST6
MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATTTSTMNNSALSR
SLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQA
AYLRQQQQQDQRQQSPSMKTEEESQLYGDILMNSGVVQDMHQNLATHTNLSQLSSTRKSA
PNDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAH
LPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHNYN
GLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYSKSQQRNFVNAPS
KNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNPSFTPKSQGSHLNLAANTQGNPI
PGTTAWKRARLLERNRIAASKCRQRKKVAQLQLQKEFNEIKDENRILLKKLNYYEKLISK
FKKFSKIHLREHEKLNKDSDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDT
GKIIAIKHEPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK* 
Transcription Factor
Binding site(s)
TGACGTCA
TTACGTAA
aTGACGTCAY
YRHACGTCAt
ttACGTCAt
GTGACGT
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator