Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Dal81p
Description Positive regulator of genes in multiple nitrogen degradation pathways; contains DNA binding domain but does not appear to bind the dodecanucleotide sequence present in the promoter region of many genes involved in allantoin catabolism
Aminoacid Sequence
Download FASTA
>YIR023W DAL81
MDPHQSPADNAASPTKSVKATTKNSSTNNNVNSNNSNNNSNHDILNFNDNYTTILQHLAN
DHPNILREKGGSQQQQHQQQQQQQQQQQQQQQQQSLDTLLHHYQSLLSKSDNAIAFDDNV
SNSADHNGSNSNNNNNNNDISSPGNLMGSCNQCRLKKTKCNYFPDLGNCLECETSRTKCT
FSIAPNYLKRTSSGANNNMPTSSNSKRMKNFEDYSNRLPSSMLYRHQQQQQQQQQQQRIQ
YPRSSFFVGPASVFDLNLTKHVRLDNVDQIQLSKTLSLRKVSPTAQFILQDDFDTTLHSK
QEYEVDLVENLVHPHGHLLVEIFFKLIHPFLPILHERVFLEKYSRSYRELTAPLLASIYS
LALQYWDFHPALLGFPKPDVTAQLNNIALETFYARVGRPKLSIIQTGLLILQCRSECHNN
WVLCSSVVALAEELGLGVECNDWKLPKWEKDLRKRLAWAVWLMDKWCALNEGRQSHLILG
RNWMIKLLNFDDFPLNSPTILNSLQNDQSGSSPSSSNDVKNHQIAFGNLPIFNINPTLED
FKNGTLMFQQMVSLSIILGEIMDTFYTQGSMTINKSIEQVLKLAKPLQLKLREWYHSLPK
NLSMSYATPQKLNSNSTLTLAYFATEITLHRKIICALNPQTPKELVQVCRTAARTRLVAA
IEFIRDLKNEHINAFWYNCSTGNLMLIGTFAALLYVTSATKEEAMIFRDYVRNYTWVLKI
GSKYFDKLSNALNNMHLLFAQIPGLLTDEPVVVSPNSNINSVNPQRSGVQSQIPIQFNVG
SPAMTEQGSPLNQWKNLPQEILQQLNSFPNGTTSTTTPVNPTSRQTQLESQGSPAINSAN
NNSNNTPLPFAPNKSSKKTSQSSPNVTPSHMSRHPPSNTSSPRVNSSTNVNSNTQMNASP
LTSINETRQESGDAADEKTAGRERTANEESSTELKDDNPNSNQETSATGNQTIKMNDDKN
VTINTRETPL* 
Transcription Factor
Binding site(s)
SAAAWNTGCGBT
GAAAATTGCGTT
CGGCN{6}GCCG
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator