Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Dal81p
Description Positive regulator of genes in multiple nitrogen degradation pathways; contains DNA binding domain but does not appear to bind the dodecanucleotide sequence present in the promoter region of many genes involved in allantoin catabolism
Aminoacid Sequence
Download FASTA
>YIR023W DAL81
MDPHQSPADNAASPTKSVKATTKNSSTNNNVNSNNSNNNSNHDILNFNDNYTTILQHLAN
DHPNILREKGGSQQQQHQQQQQQQQQQQQQQQQQSLDTLLHHYQSLLSKSDNAIAFDDNV
SNSADHNGSNSNNNNNNNDISSPGNLMGSCNQCRLKKTKCNYFPDLGNCLECETSRTKCT
FSIAPNYLKRTSSGANNNMPTSSNSKRMKNFEDYSNRLPSSMLYRHQQQQQQQQQQQRIQ
YPRSSFFVGPASVFDLNLTKHVRLDNVDQIQLSKTLSLRKVSPTAQFILQDDFDTTLHSK
QEYEVDLVENLVHPHGHLLVEIFFKLIHPFLPILHERVFLEKYSRSYRELTAPLLASIYS
LALQYWDFHPALLGFPKPDVTAQLNNIALETFYARVGRPKLSIIQTGLLILQCRSECHNN
WVLCSSVVALAEELGLGVECNDWKLPKWEKDLRKRLAWAVWLMDKWCALNEGRQSHLILG
RNWMIKLLNFDDFPLNSPTILNSLQNDQSGSSPSSSNDVKNHQIAFGNLPIFNINPTLED
FKNGTLMFQQMVSLSIILGEIMDTFYTQGSMTINKSIEQVLKLAKPLQLKLREWYHSLPK
NLSMSYATPQKLNSNSTLTLAYFATEITLHRKIICALNPQTPKELVQVCRTAARTRLVAA
IEFIRDLKNEHINAFWYNCSTGNLMLIGTFAALLYVTSATKEEAMIFRDYVRNYTWVLKI
GSKYFDKLSNALNNMHLLFAQIPGLLTDEPVVVSPNSNINSVNPQRSGVQSQIPIQFNVG
SPAMTEQGSPLNQWKNLPQEILQQLNSFPNGTTSTTTPVNPTSRQTQLESQGSPAINSAN
NNSNNTPLPFAPNKSSKKTSQSSPNVTPSHMSRHPPSNTSSPRVNSSTNVNSNTQMNASP
LTSINETRQESGDAADEKTAGRERTANEESSTELKDDNPNSNQETSATGNQTIKMNDDKN
VTINTRETPL* 
Transcription Factor
Binding site(s)
SAAAWNTGCGBT
GAAAATTGCGTT
CGGCN{6}GCCG
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator