Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gat3p
Description Protein containing GATA family zinc finger motifs
Aminoacid Sequence
Download FASTA
>YLR013W GAT3
MNIKTLCHPEYKRISVESLLNPVEETIDCEKPHSQTKINTAKPISASLYVTTNNTAVVQH
NVQKRKGVTRRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKDLAKRYFNE
IKGVSVKRKVPKSLYGVTRTR* 
Transcription Factor
Binding site(s)
gAWCTac
aGATCta
aaatBRGATCTACaagctg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator