Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Gat4p
Description Protein containing GATA family zinc finger motifs
Aminoacid Sequence
Download FASTA
>YIR013C GAT4
MSTKLPIVISNGTAFKKVPVQLLLNSGSEAQHGLPRNADSQPARPRTGITRTCGQCGEIK
TSLQWREGPNGAACLCNACGLFFRKLILRFGRAAAKRYMEQIKGTGTKRRIPKELTGTVR
F* 
Transcription Factor
Binding site(s)
AGATCta
BHxxaaTAGATCTAtWcg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator