Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Hal9p
Description Putative transcription factor containing a zinc finger; overexpression increases salt tolerance through increased expression of the ENA1 (Na+/Li+ extrusion pump) gene while gene disruption decreases both salt tolerance and ENA1 expression
Aminoacid Sequence
Download FASTA
>YOL089C HAL9
MENQGGDYSPNGFSNSASNMNAVFNNEITGRSDISNVNHQTGTPRLVPETQIWSMPVPDQ
LMTMPNRENTLMTGSTIGPNIPMNVAYPNTIYSPTEHQSQFQTQQNRDISTMMEHTNSND
MSGSGKNLKKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPCTFKHRDEILKKKRK
LEIKHHATPGESLQTSNSISNPVASSSVPNSGRFELLNGNSPLESNIIDKVSNIQNNLNK
KMNSKIEKLDRKMSYIIDSVARLEWLLDKAVKKQEGKYKEKNNLPKPARKIYSTALLTAQ
KLYWFKQSLGVKASNEEFLSPISEILSISLKWYATQMKKFMDLSSPAFFSSEIILYSLPP
KKQAKRLLENFHATLLSSVTGIISLKECLDLAEKYYSESGEKLTYPEHLLLNVCLCSGAS
ATQSIIRGDSKFLRKDRYDPTSQELKKIENVALLNAMYYYHKLSTICSGTRTLQALLLLN
RYFQLTYDTELANCILGTAIRLAVDMELNRKSSYKSLDFEEAIRRRRMWWHCFCTDKLYS
LMLSRPPIVGERDMDMLTDQNYYEVIKTNILPDLIDKKEDLDKITDVNSALNVVVNFCQH
ISLFISYYVSKLVSIESKIYSTCFAVRSTLDLSFDAMLDKIKDLNDSLNNWRDNLHVSMK
LKSYKQYLSVLYAQKSQENPALSFEIACSRVLNCHFRALYSKVILSMMTTSLLIDNERLY
KGSRHDIPQLFILFSSQYLNASKEMLQLFQGINYQAHMYNEVMYQFSTAMFVLFFYVVDN
MNDLKKKGEVKEIIDILKKSYDRLVGENDEQLLFDNVKWNTLIVFYSHFLKYVLQRYHAL
NDSTSIFDSKPYDETITKVIMHSRKIKDETVDQLIMSLKSYGSLHSLQKGNEADLADDGL
NTNDISSEDFAEEAPINLFGELSVEILKLLKSHSPISNFGDLSPSSNRKGISDDSSLYPI
RSDLTSLVYPIHSSDTGDTLSSGLETPENSNFNSDSGIKEDFEAFRALLPLGKLIYDRDY
SFVNTFRDYE* 
Transcription Factor
Binding site(s)
CGGaa
tCCGxxxxxxxxxgCGGa
CGGAR
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator