Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Ino4p
Description Transcription factor required for derepression of inositol-choline-regulated genes involved in phospholipid synthesis; forms a complex, with Ino2p, that binds the inositol-choline-responsive element through a basic helix-loop-helix domain
Aminoacid Sequence
Download FASTA
>YOL108C INO4
MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRREL
ERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSS
SSDPVQEQNGNIRDLVPKELIWELGDGQSGQ* 
Transcription Factor
Binding site(s)
ATGTGAAAT
CATGTGAAAT
WYTTCAYRTGS
TYTTCACATGY
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator