Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Ino4p
Description Transcription factor required for derepression of inositol-choline-regulated genes involved in phospholipid synthesis; forms a complex, with Ino2p, that binds the inositol-choline-responsive element through a basic helix-loop-helix domain
Aminoacid Sequence
Download FASTA
>YOL108C INO4
MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRREL
ERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSS
SSDPVQEQNGNIRDLVPKELIWELGDGQSGQ* 
Transcription Factor
Binding site(s)
ATGTGAAAT
CATGTGAAAT
WYTTCAYRTGS
TYTTCACATGY
CACATGC
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator