Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Mac1p
Description Copper-sensing transcription factor involved in regulation of genes required for high affinity copper transport
Aminoacid Sequence
Download FASTA
>YMR021C MAC1
MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQSTEYE
NGAQIEGDCCSAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEPKDISTFTDDGN
KYITETEFLRKHSPKAPATGTISPDSTKSSSSSEKKERSRLQQEPIRHFSNCCKKDKSQN
PASNGKTNKAPSDDIFTPYGSLESTSAFNDILQENYNSSVPGAHDSSETLTPQSTTTIAA
PHSSDVASKVEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGVPLTNIG
EAQITDKMMDYLDDCKCTDKECICPPDNCTCDGCFSHSTNIIPFEKFFFYGILNARLTRK
TQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKLVSNYAPHLSDATTS* 
Transcription Factor
Binding site(s)
TTTGCKCR
WWWTTTGCTCR
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator