Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mac1p
Description Copper-sensing transcription factor involved in regulation of genes required for high affinity copper transport
Aminoacid Sequence
Download FASTA
>YMR021C MAC1
MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQSTEYE
NGAQIEGDCCSAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEPKDISTFTDDGN
KYITETEFLRKHSPKAPATGTISPDSTKSSSSSEKKERSRLQQEPIRHFSNCCKKDKSQN
PASNGKTNKAPSDDIFTPYGSLESTSAFNDILQENYNSSVPGAHDSSETLTPQSTTTIAA
PHSSDVASKVEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEEELNSYIQQSGVPLTNIG
EAQITDKMMDYLDDCKCTDKECICPPDNCTCDGCFSHSTNIIPFEKFFFYGILNARLTRK
TQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKLVSNYAPHLSDATTS* 
Transcription Factor
Binding site(s)
TTTGCKCR
WWWTTTGCTCR
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator