Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mig1p
Description Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase
Aminoacid Sequence
Download FASTA
>YGL035C MIG1
MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRLEHQTRHMRIH
TGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRGRKKKVVGSPINSASSSATSI
PDLNTANFSPPLPQQHLSPLIPIAIAPKENSSRSSTRKGRKTKFEIGESGGNDPYMVSSP
KTMAKIPVSVKPPPSLALNNMNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIAS
SAPRTVFIDGPEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT
QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSSIDNLEQDYLQ
EQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFSSSSPDFQKELNNRLLNVQQQ
QQEQHTLLQSQNTSNQSQNQNQNQMMASSSSLSTTPLLLSPRVNMINTAISTQQTPISQS
DSQVQELETLPPIRSLPLPFPHMD* 
Transcription Factor
Binding site(s)
AATTRTCCGGGG
TATAGTGCGGGG
ATTTTTGTGGGG
GAATAYCTGGGG
TTATTTCTGGGG
TAAAAGCCGGGG
TTAAAAGCGGGG
TTAAACGTGGGG
ATAAAACTGGGG
ATAAACGCGGGG
ATTAATGTGGGG
AAAAATGCGGGG
ATTTTGCGGGG
CCCCRc
CCCCRcaxt
HWxxYMCCCCGCaTtHHtt
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator