Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Mot3p
Description Nuclear transcription factor with two Cys2-His2 zinc fingers; involved in repression of a subset of hypoxic genes by Rox1p, repression of several DAN/TIR genes during aerobic growth, and repression of ergosterol biosynthetic genes; can form the [MOT3+] prion
Aminoacid Sequence
Download FASTA
>YMR070W MOT3
MNADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSLASQPFNT
TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNN
SNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYS
FPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNAANNGSNNSSHSAPAPAPGPPH
HHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNPSPNLNLNINPAQPLHLP
PGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSW
LKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNNSSSS
NNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRV
LNNLIVSHNK* 
Transcription Factor
Binding site(s)
WAGGTA
CAGGYA
AAGAGG
ATGGAT
TAGGTA
TAGGAT
TMGGAA
AAGGKA
AAGGWT
RcAGGCACg
YRTGTAaW
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator