Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Nhp10p
Description Protein related to mammalian high mobility group proteins; preferentially binds DNA ends, protecting them from exonucleatic cleavage; likely component of the chromatin-remodeling complex INO80 complex; proposed to be involved in DNA repair
Aminoacid Sequence
Download FASTA
>YDL002C NHP10
MSVEEKKRRLEELKDQNVVLGLAIQRSRLSVKRLKLEYGVLLERLESRIELDPELNCEDP
LPTLASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLYCEMNKERIRQNGSLDV
TRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYNKKISNIDADDDKEENEQKIKNN
EEGSSTKVADSKGGEDGSLVSSN* 
Transcription Factor
Binding site(s)
gCCGGGGa
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator