Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Nhp6ap
Description High-mobility group (HMG) protein that binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Bp; homologous to mammalian HMGB1 and HMGB2
Aminoacid Sequence
Download FASTA
>YPR052C NHP6A
MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWK
ALTPEEKQPYEAKAQADKKRYESEKELYNATLA* 
Transcription Factor
Binding site(s)
DxatttttATATAtaRDtxa
cxHaYWaa
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator