Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Nhp6bp
Description High-mobility group (HMG) protein that binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; homologous to mammalian HMGB1 and HMGB2
Aminoacid Sequence
Download FASTA
>YBR089C-A NHP6B
MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRI
LGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA* 
Transcription Factor
Binding site(s)
cxHRYWaW
cxHRYWaaa
txtHHtWatATatWaWaxD
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator