Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Pdr3p
Description Transcriptional activator of the pleiotropic drug resistance network, regulates expression of ATP-binding cassette (ABC) transporters through binding to cis-acting sites known as PDREs (PDR responsive elements)
Aminoacid Sequence
Download FASTA
>YBL005W PDR3
MKVKKSTRSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKHLPQKEDSSQSLPT
TAVAPPSSHANVEASADVQHLDTAIKLDNQYYFKLMNDLIQTPVSPSATHAPDTSNNPTN
DNNILFKDDSKYQNQLVTYQNILTNLYALPPCDDTQLLIDKTKSQLNNLINSWNPEINYP
KLSSFSPRPQRSIETYLLTNKYRNKIHMTRFSFWTDQMVKSQSPDSFLATTPLVDEVFGL
FSPIQAFSLRGIGYLIKKNIENTGSSMLIDTKETIYLILRLFDLCYEHLIQGCISISNPL
ENYLQKIKQTPTTTASASLPTSPAPLSNDLVISVIHQLPQPFIQSITGFTTTQLIENLHD
SFSMFRIVTQMYAQHRKRFAEFLNQAFSLPHQEKSVLFSSFCSSEYLLSTLCYAYYNVTL
YHMLDINTLDYLEILVSLLEIQNEIDERFGFEKMLEVAVTCSTKMGLSRWEYYVGIDENT
AERRRKIWWKIYSLEKRFLTDLGDLSLINEHQMNCLLPKDFRDMGFINHKEFLTKIGTSS
LSPSSPKLKNLSLSRLIEYGELAIAQIVGDFFSETLYNEKFTSLEVSVKPTIIRQKLLEK
VFEDIESFRLKLAKIKLHTSRVFQVAHCKYPEYPKNDLIEAAKFVSYHKNTWFSILGAVN
NLIARLSEDPEVITEQSMKYANEMFQEWREINQFLIQVDTDFIVWACLDFYELIFFVMAS
KFYVEDPHITLEDVINTLKVFKRITNIISFFNNNLDEKDYDCQTFREFSRSSSLVAISIR
IIFLKYCYAEQIDRAEFIERLKEVEPGLSDLLREFFDTRSFIYRYMLKSVEKSGFHLIIR
KMLESDYKFLYRDKLATGNIPDQGNSSQISQLYDSTAPSYNNASASAANSPLKLSSLLNS
GEESYTQDASENVPCNLRHQDRSLQQTKRQHSAPSQISANENNIYNLGTLEEFVSSGDLT
DLYHTLWNDNTSYPFL* 
Transcription Factor
Binding site(s)
TCCGCGGA
TCCGTGGA
TCCACGGA
TCCGCGCA
TCCGCGGG
TTCCGCGGAW
TTCCGGAAtc
VCGGa
ccVCGGa
VCGGaa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator