Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Pdr8p
Description Transcription factor; targets include ATP-binding cassette (ABC) transporters, major facilitator superfamily transporters, and other genes involved in the pleiotropic drug resistance (PDR) phenomenon
Aminoacid Sequence
Download FASTA
>YLR266C PDR8
MDGSHFPMKSTTGEPVSSGKKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQCV
YTEEFNYPLSNTELFEQVPNVALVQKIENLQTLLKENDNNNAKPVYCRSSENPLRSLRTS
VLGDNGSRYVFGPTSWKTLSLFEQNKFQTEFQNLWKVLKPLPECTKSQLNENDVVADLPS
FPQMESCIKSFFAGPLFGILHIFNQDDILSLLDRLFIRDTTDKNLVILLDLQGNAKDKYN
LGIVLQILCLGYYNQDIPSSVSHFLHTLSAASLSSSSSNFVEKLQFFLLSYISVMINCTD
GVWDATQGVDLINELCQGCISLGLNDIDKWYLNESEETKQNLRCIWFWALFLDVSTSYDI
GNPPSISDDLLDLSIFTAQNFQSPSIDFRRVKLMHDFLDVSRFTTREIHKREMNEKLTTF
SLRLIEFIQSNFSPIEHYTNSVYYSDIDPFDILILSRSLSIVASIYNIEMIIAQQSRIID
KNRMVQFLLISISVCVNTMVFHFKEPINDQENVLTEGLKLSIILINPLLIRIVSQVYSLA
FNRLIFREKAFLFLIDLDTGKKIQFIKYEEENFDELLTGFDVRTDKFLSFSGTIIRFYEI
IDSIFAVNERNKRLLKAVSNFYQLTSTLAFERVSRVLFDKASQARIETEKIWLKKGINME
HFSDLMIEDFINDVWKTFKEISKDLWSIDKKKFYKQYHFDL* 
Transcription Factor
Binding site(s)
TCCGHGGA
VCGGAGAt
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator