Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Reb1p
Description RNA polymerase I enhancer binding protein; DNA binding protein which binds to genes transcribed by both RNA polymerase I and RNA polymerase II; required for termination of RNA polymerase I transcription
Aminoacid Sequence
Download FASTA
>YBR049C REB1
MPSGHNDKNANQESVEEAVLKYVGVGLDHQNHDPQLHTKDLENKHSKKQNIVESSSDVDV
NNNDDSNRNEDNNDDSENISALNANESSSNVDHANSNEQHNAVMDWYLRQTAHNQQDDED
DENNNNTDNGNDSNNHFSQSDIVVDDDDDKNKKDAGVGVDDDHQSMAMAAVAAAYTLSKN
NNNNNSIANDSNSRKRQHDNGNNHENSQKKRKNNNDDDDRQIGNVDPELTTLGDADDNDT
NNDVIDRDQLVHKAIIDADSITQHPDFQQYLNTAADTDDNEKLKHIKDHLMRTHGLNHQN
KNHNDDTDDLSNSTKQYSELQKDSMLDSSLNKSRNYMEVLPKVISQDTQPHQQKSPSHDN
EAGSVDNSEISQLLQSAATKASSLVSLSSSSATPSTSRSNNSKAFDKAEDAALERFINEY
EAIERLTRQQVCERIWSSDRPKDNFWNNIYKVLPYRSSSSIYKHMRRKYHIFEQRGKWTA
EEEQELAKLCAEKEGQWAEIGKTLGRMPEDCRDRWRNYVKCGTNRASNRWSVEEEELLKK
VISDMLEEAQQQQSQLHPNLLEEEQHLLQDDQNDHRNNDEDDDDTASAAAAAAAAIQEQQ
QLLQQKQQDDDDAIAAAAAAASSSLGDNKDEDKPHDSLGIQLDDNSQNSMVPAPSATSTH
SKSLSNTIRRHNNKLRKSLMGNGKLDFKDIINWTIVSERMGGTRSRIQCRYKWNKLVKRE
AIAKIQTVKDDDMLWIFEKLRDLGITEDSQVDWDELAALKPGMKLNGLELKLCYERMKKK
VKGYKQKSINEISKELVDYFSSNISMKTEN* 
Transcription Factor
Binding site(s)
CCGGGTAA
TGTTACCCGT
CCGGGTGGAT
cMGGGTAAc
cMGGGTAA
MGGGTAAB
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator