Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Rfx1p
Description Major transcriptional repressor of DNA-damage-regulated genes, recruits repressors Tup1p and Cyc8p to their promoters; involved in DNA damage and replication checkpoint pathway; similar to a family of mammalian DNA binding RFX1-4 proteins
Aminoacid Sequence
Download FASTA
>YLR176C RFX1
MVIFKERKPTENLFTRKIPAKYFIFSPSFLSVHYFEFYLPMSGDNNIEPTSRGSNDNSNG
PSNGSSVNSNRYSLNAPKYSSQPPPASHTYLPPMSVNIPPIASKSSSIYSLLHQSSPRPE
TPNPILPPLIGSGPGSHKPSPTPTQPPAQPATQRQPATYSVYPASISLNRSNSSAYPLSF
KSEETLNNNPPTAAKRTNTFPSIPSSTKKQKTSQEKRISSISRRNTQEIIAKQIAENNKS
KTIEEYAQIVKHAEIKVLSMDSQNTSKAALQLAEQNRERERQVFALLWLMKNCKSQHDSY
VPRGKIFAQYASSCSQNNLKPLSQASLGKLIRTVFPDLTTRRLGMRGQSKYHYCGLKLTV
NESGSVSLNNNNASLSLVHNNDPISPLSSPSPSSPSPQVPNVSSPFSLNRKSLSRTGSPV
KQSSNDNPNEPELESQHPNETEANKLDSLPPAANNPTGTLSSDELTFTHDLIEKVFNCND
KLSDNYNTQILSNTEHPLLTSYKLDFPKIPAGVLPTDTDSDVISSLESLYHIHCNSVYEC
IKFLKSDNISNALFFSNSNSISPTMFNLFISEPLIDWVTKCDLITYTGLIKFFSQFIIHS
NEISDSIIQKLESMIKLLPEQINKAVLELPKALVQRKLSIINNFTKLVKKLIKLLKFILN
FLKSFPIFKSGMNNDWKNIVNLDDILEMMINEDDTNSETNTIMQHLQGFCQVFVTKFLNS
SMSVSNDPSVSIECKSLNEMIKDFCSFISLQSKFSCLKLIDCSTRFRNAIIGDISLKSNE
NLLSWLFLNNVMGQLLNYCFEVMKFVNGLKV* 
Transcription Factor
Binding site(s)
TCGCCATGGCAAC
TTGCCATGGCAAC
TCGCCATGACAAC
CTATTGCTGCAAC
TCTCTGTGGCAAC
TTGTCACAGCAAC
TTGTCGCAGCAAC
TTGTTGTGGCAAC
TTTCCACAGCAAC
TYGCCATGCCAAC
TRGYAACc
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator