Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Rme1p
Description Zinc finger protein involved in control of meiosis; prevents meiosis by repressing IME1 expression and promotes mitosis by activating CLN2 expression; directly repressed by a1-alpha2 regulator; mediates cell type control of sporulation
Aminoacid Sequence
Download FASTA
>YGR044C RME1
MSPCYGQNSAIAKGSWNREVLQEVQPIYHWHDFGQNMKEYSASPLEGDSSLPSSLPSSTE
DCLLLSLENTITVIAGNQRQAYDSTSSTEEGTAPQLRPDEIADSTHCITSLVDPEFRDLI
NYGRQKGANPVFIESNTTEQSHSQCILGYPQKSHVAQLYHDPKVLSTISEGQTKRGSYHC
SHCSEKFATLVEFAAHLDEFNLERPCKCPIEQCPWKILGFQQATGLRRHCASQHIGELDI
EMEKSLNLKVEKYPGLNCPFPICQKTFRRKDAYKRHVAMVHNNADSRFNKRLKKILNNTK
* 
Transcription Factor
Binding site(s)
GTACCACAAAA
GTACCTCAAAA
GAACCTCAARA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator