Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rme1p
Description Zinc finger protein involved in control of meiosis; prevents meiosis by repressing IME1 expression and promotes mitosis by activating CLN2 expression; directly repressed by a1-alpha2 regulator; mediates cell type control of sporulation
Aminoacid Sequence
Download FASTA
>YGR044C RME1
MSPCYGQNSAIAKGSWNREVLQEVQPIYHWHDFGQNMKEYSASPLEGDSSLPSSLPSSTE
DCLLLSLENTITVIAGNQRQAYDSTSSTEEGTAPQLRPDEIADSTHCITSLVDPEFRDLI
NYGRQKGANPVFIESNTTEQSHSQCILGYPQKSHVAQLYHDPKVLSTISEGQTKRGSYHC
SHCSEKFATLVEFAAHLDEFNLERPCKCPIEQCPWKILGFQQATGLRRHCASQHIGELDI
EMEKSLNLKVEKYPGLNCPFPICQKTFRRKDAYKRHVAMVHNNADSRFNKRLKKILNNTK
* 
Transcription Factor
Binding site(s)
GTACCACAAAA
GTACCTCAAAA
GAACCTCAARA
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator