Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Rsc3p
Description Component of the RSC chromatin remodeling complex; essential gene required for maintenance of proper ploidy and regulation of ribosomal protein genes and the cell wall/stress response; highly similar to Rsc30p
Aminoacid Sequence
Download FASTA
>YDR303C RSC3
MDIRGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDVPGQYVPSSSSSSN
TRQVANGPYLNSYYASRRVSKETAALLQKNPELASLEQIREYNTRLQLLNAQNQLNNRSS
AANATLNQQHTQYIPKSVPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQDEIINH
EMNFLKGRLLELQEITGKKITGVNLDLKQDSSAQMQSSHSNRNQEEFLTIKKRKLSEDGV
TDGDGKPIPESERRPHLNEFKDLDPQFLDTNKVFNVFNSAISEEGRNRLWLLPKNINKSS
IFQIQYLIERDPFLFKFFNDLNILIETQFNGPLHDLVASRNSIERNSGISQILKFPSQSI
TQTLINKYLSTITETNSILPILKPKRLLPIVEQLFPSNTINKPNSKDFETIFQVFSVTND
QLLNLGFITLCLLILFESLNSTVLIPLRDDEHLQLFNVLFNYLPLLKSNLTTLRFEIEKR
SMCNIETLRFISLWKYYQFVMDTSSSSSFVIDYDEDMHMACLLSLNHETQNQSHILTWNF
IFKNYCWRHLFLGQLPLLMSEPFTNSTPIIDPLLNNDFELIDFEVNLMKYLQSKDQQLSI
DKIIQLIKLLKNKNIEVSQGCLTTPSIINNIMDSLIYRNSMLYLNFYLLLQFETLKNYAK
FNEILEDFLELSRETLFFVFSNLANIKFAGHEFTFINKSIVVLQTLVLMLLALYQRSFDS
SKRTNDANEISEQTDIHSNNDNSKRIKNKNVIHLIINKIAMLLSDYTKNCKKQNKLIENL
IIKIKTISKYIKNLEENKVTTSADSNYSINNGFSGISAEQLIKLNHELSKISESLIKTDF
YEQRKNSTVSNGVLGAAAPVDSDANSDTFGLTKENFNEVFEAIRS* 
Transcription Factor
Binding site(s)
CGCGc
HaWMaxaVCGCGCGctxtxtg
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator