Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sok2p
Description Nuclear protein that plays a regulatory role in the cyclic AMP (cAMP)-dependent protein kinase (PKA) signal transduction pathway; negatively regulates pseudohyphal differentiation; homologous to several transcription factors
Aminoacid Sequence
Download FASTA
>YMR016C SOK2
MPIGNPINTNDIKSNRMRQESNMSAVSNSESTIGQSTQQQQQQQQYLGQSVQPLMPVSYQ
YVVPEQWPYPQYYQQPQSQSQQQLQSQPQMYQVQESFQSSGSDSNASNPPSTSVGVPSNA
TATALPNGSAITTKKSNNSTNISNNVPYYYYFPQMQAQQSMAYSYPQAYYYYPANGDGTT
NGATPSVTSNQVQNPNLEKTYSTFEQQQQHQQQQQLQAQTYPAQPPKIGNAFSKFSKSGP
PSDSSSGSMSPNSNRTSRNSNSISSLAQQPPMSNYPQPSTYQYPGFHKTSSIPNSHSPIP
PRSLTTPTQGPTSQNGPLSYNLPQVGLLPPQQQQQVSPLYDGNSITPPVKPSTDQETYLT
ANRHGVSDQQYDSMAKTMNSFQTTTIRHPMPLIATTNATGSNTSGTSASIIRPRVTTTMW
EDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVVKIGSM
HLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQNNPSNDSSSSSSSTGIKSISP
RTYYQPINNYQNPNGPSNISAAQLTYSSMNLNNKIIPNNSIPAVSTIAAGEKPLKKCTMP
NSNQLEGHTITNLQTLSATMPMKQQLMGNIASPLSYPRNATMNSASTLGITPADSKPLTP
SPTTTNTNQSSESNVGSIHTGITLPRVESESASHSKWSKEADSGNTVPDNQTLKEPRSSQ
LPISALTSTDTDKIKTSTSDEATQPNEPSEAEPVKESESSKSQVDGAGDVSNEEIAADDT
KKQEK* 
Transcription Factor
Binding site(s)
acMTGCAKg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator