Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Srd1p
Description Protein involved in the processing of pre-rRNA to mature rRNA; contains a C2/C2 zinc finger motif; srd1 mutation suppresses defects caused by the rrp1-1 mutation
Aminoacid Sequence
Download FASTA
>YCR018C SRD1
MRYNNYDNSGSSFLTRVVKKSDMEKTLLLNREIDDWKSNDKKKAYKERGRVYASCSFIEV
SFSQIRAVDVEKKIENAEQLRDLTRNIVKNKTSSLNEITPSKNRVTSACNSERRTTSQEA
NNLEGYHSCAQGTSRSASITKKYSKKTTSRPKREKRQTILPNGEIKECSKCKDTWTIQWR
SGPDQNRELCSPCGLAYGKRLKKENEKKRQAADKRIDRNNP* 
Transcription Factor
Binding site(s)
gtAGWTcB
gtaGATCt
gtAGWTc
cxxtttGTAGATCYcaH
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator