Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Stb4p
Description Protein that binds Sin3p in a two-hybrid assay; contains a Zn(II)2Cys6 zinc finger domain characteristic of DNA-binding proteins; computational analysis suggests a role in regulation of expression of genes encoding transporters
Aminoacid Sequence
Download FASTA
>YMR019W STB4
MSINHEIYYILVFEHRSVAIKLIIVVIVLLQFFLARSRQIDRTWAHTNRKERFREMTAIG
NTDDALDTSTAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYDFKAT
NRKRRRRQVASAVRDVSKTYAETSESFPRDLLSKSNIIINAPSDGVSSSASNSPNPNSHY
HHISSTLPFMSGRPNHTFHSGSNLNGENNNNSFPEDHMAKLLLQLSSKLGNTTKESSIRT
TRTNASDVNANPTVVNMKNSQEDCDTNHRSAICDSAEALHNNNINSKENKIINSQITNTV
NDHFESPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNL
SGGHYLKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATF
WQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFE
EKSILIKKPSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALS
QAVNMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMC
EQMNLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWY
DTFIVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCLIAPSSTANNKSLEYVVD
TELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKAIMQ
SCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDDTPN
RNKFEQFKKVGDNDADVEVDAGEREENADERQENPHNNSKRVPLATRSHNTTNFDGSIAI
SPESAVANLGTDTGLPSDVLDTVSKIGNSPNVFDDDLFSNLLWFDQNFA* 
Transcription Factor
Binding site(s)
TCGGgCCGA
YTCGGATa
YTCGGAA
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator