Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Stp3p
Description Zinc-finger protein of unknown function, possibly involved in pre-tRNA splicing and in uptake of branched-chain amino acids
Aminoacid Sequence
Download FASTA
>YLR375W STP3
MSNANNSAMNHITLPPISSFDNLIKAAERQYNGEASSASTHPTLPNMNISNGSGSAGASS
SMLSYQLLPHSNDVSRSNSSSSFLPSVQQPTEGSASASETSSSASPSRSISPILKVAGPS
SVGGAGVSTPHSTKINKPRKKKQCPICRNFYANLTTHKATHLTPEDRPHKCPICHRGFAR
NNDLLRHKKRHWKDEILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSL
HQIKGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQTGVFSRCDTFKNHLKALHFEY
PPGTKKKDRNVVPGRCKHCGLKFENVDVWLNEHVGKQCGYKYH* 
Transcription Factor
Binding site(s)
gcTAGCGca
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator