Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Sut1p
Description Transcription factor of the Zn[II]2Cys6 family involved in sterol uptake; involved in induction of hypoxic gene expression
Aminoacid Sequence
Download FASTA
>YGL162W SUT1
MSTSITVRNRDRSLPPLLLPNVSLLEKDIRRKGTQNVGITDPELLSTTWTRKRAFPTDEL
LGGYKRLKPAAADSNECAIGIATVTPPPTLPVSAIVPPPQNYTPPLFEYHPHALASMVNE
DANASCTQMSIISRSTSNSTTSSATSTSSISKRQRSGPSCDKCRLKKIKCNAKIEILLQD
DTIMPMISNKLRYVLTPDDIRLYRGTLLRNIAIPDDVIEGTGSRKLIKHIDKLVLLTPCL
PCIKKKHSSSSTNFPKNDKCTFSKGFTRADINISSKISLKFKDKTIYDITYDDYKSIDF* 
Transcription Factor
Binding site(s)
cYCGGASTTY
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator