Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Swi5p
Description Transcription factor that activates transcription of genes expressed at the M/G1 phase boundary and in G1 phase; localization to the nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase
Aminoacid Sequence
Download FASTA
>YDR146C SWI5
MDTSNSWFDASKVQSLNFDLQTNSYYSNARGSDPSSYAIEGEYKTLATDDLGNILNLNYG
ETNEVIMNEINDLNLPLGPLSDEKSVKVSTFSELIGNDWQSMNFDLENNSREVTLNATSL
LNENRLNQDSGMTVYQKTMSDKPHDEKKISMADNLLSTINKSEINKGFDRNLGELLLQQQ
QELREQLRAQQEANKKLELELKQTQYKQQQLQATLENSDGPQFLSPKRKISPASENVEDV
YANSLSPMISPPMSNTSFTGSPSRRNNRQKYCLQRKNSSGTVGPLCFQELNEGFNDSLIS
PKKIRSNPNENLSSKTKFITPFTPKSRVSSATSNSANITPNNLRLDFKINVEDQESEYSE
KPLGLGIELLGKPGPSPTKSVSLKSASVDIMPTIPGSVNNTPSVNKVSLSSSYIDQYTPR
GKQLHFSSISENALGINAATPHLKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENE
PESRFVISETPSPVLKSQSKYEGRSPQFGTHIKEINTYTTNSPSKITRKLTTLPRGSIDK
YVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRH
KKSHQEKAYACPCGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSS
VSSSPIKENINKDHNGQLMFKLEDQLRRERSYDGNGTGIMVSPMKTNQR* 
Transcription Factor
Binding site(s)
ACCAGC
DaCCAGCa
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator