Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tbf1p
Description Telobox-containing general regulatory factor; binds TTAGGG repeats within subtelomeric anti-silencing regions (STARs), blocking silent chromatin propagation; binds majority of snoRNA gene promoters, required for full snoRNA expression
Aminoacid Sequence
Download FASTA
>YPL128C TBF1
MDSQVPNNNESLNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVL
TDQTAFLSSGETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHE
AFIITAIRKANLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQSGKFLKSQ
AILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITL
LTPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRG
KSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSS
KNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEAL
VEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIK
VTGNLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPS
NGLFGNSTSDNTGFDPHLEDGM* 
Transcription Factor
Binding site(s)
aRCCCTaa
txxxgtARCCCTAAtaxg
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator