Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Tos8p
Description Homeodomain-containing protein and putative transcription factor found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; similar to Cup9p transcription factor
Aminoacid Sequence
Download FASTA
>YGL096W TOS8
MGTSIVNLNQKIELPPIQVLFESLNRENETKPHFEERRLYQPNPSFVPRTNIAVGSPVNP
VPVSSPVFFIGPSPQRSIQNHNAIMTQNIRQYPVIYNNNREVISTGERNYIITVGGPPVT
SSQPEYEHISTPNFYQEQRLAQPHPVNESMMIGGYTNPQPISISRGKMLSGNISTNSVRG
SNNGYSAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQ
ISNWFINARRRKIFSGQNDANNFRRKFSSSTNLAKF* 
Transcription Factor
Binding site(s)
ttTGACAg
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator