Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Tye7p
Description Serine-rich protein that contains a basic-helix-loop-helix (bHLH) DNA binding motif; binds E-boxes of glycolytic genes and contributes to their activation; may function as a transcriptional activator in Ty1-mediated gene expression
Aminoacid Sequence
Download FASTA
>YOR344C TYE7
MNSILDRNVRSSETTLIKPESEFDNWLSDENDGASHINVNKDSSSVLSASSSTWFEPLEN
IISSASSSSIGSPIEDQFISSNNEESALFPTDQFFSNPSSYSHSPEVSSSIKREEDDNAL
SLADFEPASLQLMPNMINTDNNDDSTPLKNEIELNDSFIKTNLDAKETKKRAPRKRLTPF
QKQAHNKIEKRYRININTKIARLQQIIPWVASEQTAFEVGDSVKKQDEDGAETAATTPLP
SAAATSTKLNKSMILEKAVDYILYLQNNERLYEMEVQRLKSEIDTLKQDQK* 
Transcription Factor
Binding site(s)
TCACGTG
tgcRTCACGTGAYgcxxc
cRtCAcgtga
atCAcStgaB
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator