Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Uga3p
Description Transcriptional activator necessary for gamma-aminobutyrate (GABA)-dependent induction of GABA genes (such as UGA1, UGA2, UGA4); zinc-finger transcription factor of the Zn(2)-Cys(6) binuclear cluster domain type; localized to the nucleus
Aminoacid Sequence
Download FASTA
>YDL170W UGA3
MNYGVEKLKLKYSKHGCITCKIRKKRCSEDKPVCRDCRRLSFPCIYISESVDKQSLKKIK
ADIQHQLISKKRKHAPDSAQKAAVATRTRRVGSDEQDNQVYLSKPLEDCISQKLDSMGLQ
LYNYYRSHLANIISIAPMNQNYYLNIFLPMAHENDGILFAILAWSANHLSISSSNELRKD
EIFVNLANKYTYMSLSHLKTNEGSSACAKLGFLYSLAQILILCGSEICQGDVKFWKILLN
IGKNLIENHVGKDVSRILTTTTEEPSLEERIIFPNFNSVVKYWLIVNFIYHDILNFNTTS
FPIEQYEKFFQRDQNSLPSSANFIESIDSPIEEIDPLIGINKPILLLLGQVTNLTRFLQT
MEQEEMLEHGDKILSLQVEIYKLQPSLMALEHLDDEKKFYYLELFEIMKISTLMFFQLTL
LKIDKDSLELQILRNKLDSKLDKVIGTFLEGSLCFPLFIYGVCIQVEDMEKKIDLEAKFD
DILKRYKCYNFQNARLLIRKIWQNEADGISEHDLVHMIDELDYNINFA* 
Transcription Factor
Binding site(s)
SGCGGNWTTT
cSGCGGSA
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator