Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Usv1p
Description Putative transcription factor containing a C2H2 zinc finger; mutation affects transcriptional regulation of genes involved in growth on non-fermentable carbon sources, response to salt stress and cell wall biosynthesis
Aminoacid Sequence
Download FASTA
>YPL230W USV1
MENTTNRNTAGVLTSSNGNFATNSVAASTPKRSKSARRKTFKCTGYDGCTMSFTRAEHLA
RHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKNHHSTSSHQRKPSSSSLSSSSS
ASSSSSASSSTSYSDPYRKTNINSGNMPMMAENEKAPQIIHSSPEFITSTRSIPPISPRS
IYNTQRQQQHQQQQHQQAPYYFPSHPITDSYYQYPLPSNNNTINYLPSVDVQYPLNVSPS
STSHPASEVIISSFPPRSMPSTSFKYKDSADFQARTTMNKYNIRPSNINVNTSNINNHLD
SFSPPFSPSTTVAEAKPIILPQYQQAFSQPPNGNKNNNMSSSKNGGKGGENFKNTDDRND
NNNKKRSETLSESDISVNTNKKRLSVDYILT* 
Transcription Factor
Binding site(s)
AGGGG
tcAGGgg
BaxaaaTTCAGGGGKaa
TCAGGGGT
TCAGGTAC
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator