Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

Protein Name Vhr2p
Description Non-essential nuclear protein; null mutation has global effects on transcription
Aminoacid Sequence
Download FASTA
>VHR2 YER064C
MIDDTENSKIHLEGSHKTGKYTGYGTTHKIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ
HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSVRRNRKRSKKKLLDSKKKI
ARGKVQKIPLSPPSSSNMGSCSASNASSSDEEASVKEEPAEHALPSLNTITSQKLLPYPN
GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI
IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK
DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF
MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK
QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR
LKMLSAISLQIENSTFSKPFSTISK* 
Transcription Factor
Binding site(s)
GATGACTCAY
ATGACTDCacgc
External source Open in SGD external link
w3c xhtml validator w3c css validator