Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Vhr2p
Description Non-essential nuclear protein; null mutation has global effects on transcription
Aminoacid Sequence
Download FASTA
>VHR2 YER064C
MIDDTENSKIHLEGSHKTGKYTGYGTTHKIRAQLNFNDEKKWKKFSSRRLELIDSFGLSQ
HKASEQDDNIRQIATILRSEFEYPDTFSAEFEKLVTAAVQSVRRNRKRSKKKLLDSKKKI
ARGKVQKIPLSPPSSSNMGSCSASNASSSDEEASVKEEPAEHALPSLNTITSQKLLPYPN
GRTLPPVPTQVRSLLKKNASLLRDPSAPYAHGGDEKLQKFDIEDQPLESEQEYDFIAKSI
IVEIVNNAIPLPEQIQRDKFIRPNLTKKKGCQSKVVISNNLRKLILSKIHNSRTCLEMSK
DERNLDSFANLETLGKNSLMASISLVVENSFSHLPSSTKQYLTERLSSIEFLTILSQRLF
MPATRQLFADLSQEKIQVRVLNLILGSLVKDYGFDASLAPINEIIYHMTLHQYPLVCSNK
QSNPMRPHSTSEVLSAHSSTKDASTPGKEEPRVTRSSTSADSTIITLPSIEVPNTYDDDR
LKMLSAISLQIENSTFSKPFSTISK* 
Transcription Factor
Binding site(s)
GATGACTCAY
ATGACTDCacgc
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator