Yeastract
YEASTRACT+ INESC-ID IST IBB
Home > Go Back > View Contact/Credits     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YBL054w
Description PAC motif binding protein involved in rRNA and ribosome biogenesis; subunit of the RPD3L histone deacetylase complex; Myb-like HTH transcription factor, similar to Dot6p; hypophosphorylated by rapamycin treatment in a Sch9p-dependent manne
Aminoacid Sequence
Download FASTA
MTLPKLSSVSVSSGHVSANSHGFSILSKHPHPNNLVHSHSLSHTNAKSHLPISSTSTKEN
STNKEEAESLKKNNPSSWDPSDDIKLRHLKEIKNLGWKEIAHHFPNRTPNACQFRWRRLK
SGNLKSNKTAVIDINKLFGVYATGDATPSAGTPSAEEAVKEEAVEDEDITAGSSAIEDSP
PDFKPLVKPKYMDRKLITQRSTSTFSDHEPQHTKPRKLFVKPRSFSHSITTNTPNVKTAQ
QTNLSLYNTTSAKTNKAVNSNDYENIGLVPKIIIRSRRNSFIPSTQIPHSTTKTRKNSHS
VISSRRSSFNMMHSRRSSFNSHAPTEPISRRASLVVSPYMSPRRLSTSQSVHYHPQHQYY
LNPIASPNCKTDHANDKITHTRTFLDMQKFANKHPWSREDDEVLLNNTKDKQNHLSPLEI
SIVLPNNRSELEIQQRMDYLKRKGRVSGFHTNEGCKDEEEEDDIDPLHKENGINTPSQQS
QNYGMLEAKHDNPKSSELSSMTSANDIRNEQDELPGINSIFKNIF* 
Transcription Factor
Binding site(s)
aDcgCGATGAGStxHxV
cGATG
CGATGSSc
Regulon See Venn diagram regulon   
Documented targets See documented regulated genes
Potential targets See potential regulated genes (Attention! Can return hundreds of genes)
External source Open in SGD external link
w3c xhtml validator w3c css validator