Yeastract IST IBB-BSRG INESC-ID
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name YNR063w
Description Putative zinc-cluster protein of unknown function
Aminoacid Sequence
Download FASTA
>YNR063W YNR063W
MDRSKDARKRSISLACTVCRKRKLKCDGNKPCGRCIRLNTPKECIYNIDKRKDKRKIKNG
SKVFLFKNNTIDNGNNSILENKGLNEDLSSHIYEKEAPKFDSDIDISRFGTNDAVIFNND
GWDTSLPIDFDFDEFNTETTDFDDFLKLLGDNSPSKEQKSLSYSPTATGLSGVVKETESE
DNAPTRSRLIDVLFENKLHSVPGISKWHLYELESQYPNLECTEGNSDEKFLLSTVLCLGS
LTIRKRELLNHSNIDNRPLLPENSISKLTTDAFKYYNAAKTLVPDLLSHPTIDGFCGLVL
MANFMTMMISLEHQLYLSINALQLAVALNLNNNTKCKELLESNSDGIGVILLFWNIWCSS
CMLATIHGKNPFITLEQITTPLPCEISPRNKTNKLLIDFMQIRIKLATLQSKIFQRLYTS
STANEVPFVNLEREFEEVSLQITRLKGFPIFEEHLFYRSRVLMLELSCLRAQASFLLYRP
YLITGESLQAVTMAKSIIHEIWSQYTKQFPDNEKERHERLDWNFCYPLRTASLTLCISCI
ILLRYKQVVQFLKGTELFEYILALEILQDLVQVLPIEQNLIDIIKYPISPVQLSGDSFVE
FWGRILY* 
Transcription Factor
Binding site(s)
cxxxxaWTCTCCGAxxxcV
tCGGAGAW
Wtctccga
See regulon   
See documented regulated genes
See potential regulated genes (Attention! Can return hundreds of genes)
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator