Yeastract IST INESC-ID IBB-BSRG
Home > Go Back > View Contact Us     Tutorial     Help

 

Protein Information

orfgene link protein link go link menu
Protein Name Cmr3p
Description Putative zinc finger protein; YPR013C is not an essential gene
Aminoacid Sequence
Download FASTA
>YPR013C YPR013C
MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNYKSNLPLQVSAVDQLSTGKGTQFYGHNSY
KNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMNVVPIVNEIYTPI
SMNATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMVPTVYKPLTPYDKEPITIASE
PNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSD
WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML
RHLKSHERKRNKVLNTT* 
Open in SGD external link
w3c xhtml validator w3c css validator w3c xhtml+rdfa validator